제품 > 항체 > 단일클론항체(mAb)

S100A10 Rabbit mAb (A13614)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using S100A10 Rabbit mAb (A13614) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - S100A10 Rabbit mAb (A13614)

Immunohistochemistry analysis of paraffin-embedded human esophageal using S100A10 Rabbit mAb (A13614) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	S100A10 Rabbit mAb
Catalog No.	A13614
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0720

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903).
Sequence	MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Gene ID
Swiss Prot
Synonyms	42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG; S100A10
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, U-87MG
Cellular location	cell surface, cytoplasm, extracellular exosome, extracellular region, extracellular space, nuclear matrix, plasma membrane protein complex
Customer validation	WB(Homo sapiens)