Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | S100A12 Rabbit pAb |
---|---|
Catalog No. | A12499 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1). |
---|---|
Sequence | MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Gene ID | |
Swiss Prot | |
Synonyms | p6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE; S100A12 |
Calculated MW | 10kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Immunohistochemistry |
Positive samples | |
Cellular location | Cell membrane, Cytoplasm, Peripheral membrane protein, Secreted, cytoskeleton |
Customer validation | IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12499? Please let us know so that we can cite the reference in this datasheet.