Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using (A9355) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of SAMM50 in paraffin-embedded mouse heart tissue using SAMM50 Rabbit mAb (A9355) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SAMM50 in paraffin-embedded human colon tissue using SAMM50 Rabbit mAb (A9355) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SAMM50 in paraffin-embedded human liver cancer tissue using SAMM50 Rabbit mAb (A9355) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SAMM50 in paraffin-embedded human kidney tissue using SAMM50 Rabbit mAb (A9355) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SAMM50 in paraffin-embedded human tonsil tissue using SAMM50 Rabbit mAb (A9355) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | SAMM50 Rabbit mAb |
|---|---|
| Catalog No. | A9355 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2784 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAMM50 (Q9Y512). |
|---|---|
| Sequence | FELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | OMP85; SAM50; TOB55; TRG-3; CGI-51; YNL026W; SAMM50 |
| Calculated MW | 52kDa |
| Observed MW | 52kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | 293T, HepG2, RD, Mouse heart, Mouse skeletal muscle, Rat heart, Rat pancreas |
| Cellular location | Cytoplasm, Mitochondrion, Mitochondrion outer membrane, Multi-pass membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
