Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:SARS-CoV-2
Product name | SARS-CoV-2 ORF8 Rabbit pAb |
---|---|
Catalog No. | A20235 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-121 of coronavirus ORF8 (YP_009724396.1). |
---|---|
Sequence | MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
Gene ID | |
Swiss Prot | |
Synonyms | |
Calculated MW | 14kDa |
Observed MW | Refer to figures |
Reactivity | SARS-CoV-2 |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | |
Cellular location | |
Customer validation | WB(Homo sapiens, Chlorocebus aethiops) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20235? Please let us know so that we can cite the reference in this datasheet.