제품 > 항체 > 단일클론항체(mAb)

SDHB Rabbit mAb (A23832)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SDHB Rabbit mAb (A23832) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunohistochemistry - SDHB Rabbit mAb (A23832)

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using SDHB Rabbit mAb (A23832) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SDHB Rabbit mAb (A23832) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using SDHB Rabbit mAb (A23832) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - SDHB Rabbit mAb (A23832)

Immunofluorescence analysis of paraffin-embedded Mouse heart using SDHB Rabbit mAb (A23832) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining.

Review

Overview

Product name	SDHB Rabbit mAb
Catalog No.	A23832
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61606

Background

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human SDHB (P21912).
Sequence	AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
Gene ID
Swiss Prot
Synonyms	SDHB; CWS2; IP; PGL4; SDH; SDH1; SDH2; SDHIP; succinate dehydrogenase complex iron sulfur subunit B
Calculated MW	31kDa
Observed MW	32kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:30000 IHC-P 1:200 - 1:2000 IF 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	SK-MEL-28, K-562, 293T, Mouse heart, Rat heart
Cellular location	Matrix side, Mitochondrion inner membrane, Peripheral membrane protein.
Customer validation	(Kidney, liver) WB(Mus musculus)