Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SDS Rabbit pAb |
---|---|
Catalog No. | A12898 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human SDS (NP_006834.2). |
---|---|
Sequence | TTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGG |
Gene ID | |
Swiss Prot | |
Synonyms | SDH; SDS |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Rat liver |
Cellular location | Cytoplasm |
Customer validation | WB(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12898? Please let us know so that we can cite the reference in this datasheet.