Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SEC11A Rabbit pAb |
---|---|
Catalog No. | A10552 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-145 of human SEC11A (NP_055115.1). |
---|---|
Sequence | KGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF |
Gene ID | |
Swiss Prot | |
Synonyms | SPC18; SPCS4A; SEC11L1; sid2895; 1810012E07Rik; SEC11A |
Calculated MW | 21kDa |
Observed MW | 21kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | SGC-7901, HT-29, Raji, HepG2, A-549, Mouse kidney, Mouse liver, Mouse lung, Rat brain |
Cellular location | Endoplasmic reticulum membrane, Microsome membrane, Single-pass type II membrane protein |
Customer validation | IHC(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10552? Please let us know so that we can cite the reference in this datasheet.