Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SERCA1/ATP2A1 Rabbit mAb |
---|---|
Catalog No. | A22614 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58464 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human SERCA1/ATP2A1. (NP_775293.1). |
---|---|
Sequence | ALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERR |
Gene ID | |
Swiss Prot | |
Synonyms | ATP2A; SERCA1; SERCA1/ATP2A1 |
Calculated MW | 110kDa |
Observed MW | Refer to figures |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse skeletal muscle |
Cellular location | H zone, I band, Mitochondrion, Perinuclear region of cytoplasm, Sarcoplasmic reticulum |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.