제품 > 항체 > 단일클론항체(mAb)

SERCA2/ATP2A2 Rabbit mAb (A11692)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SERCA2/ATP2A2 Rabbit mAb (A11692) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - SERCA2/ATP2A2 Rabbit mAb (A11692)

Confocal imaging of Hep G2 cells using SERCA2/ATP2A2 Rabbit mAb (A11692, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - SERCA2/ATP2A2 Rabbit mAb (A11692)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SERCA2/ATP2A2 antibody (A11692). Western blot was performed from the immunoprecipitate using SERCA2/ATP2A2 antibody (A11692) at a dilution of 1:3000.

Overview

Product name	SERCA2/ATP2A2 Rabbit mAb
Catalog No.	A11692
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0679

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of the skeletal muscle. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Other types of mutations in this gene have been associated with various forms of muscular dystrophies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 943-1042 of human SERCA2/ATP2A2 (P16615).
Sequence	HFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS
Gene ID
Swiss Prot
Synonyms	DD; DAR; ATP2B; SERCA2; SERCA2/ATP2A2
Calculated MW	115kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, NIH/3T3, RD, Rat brain
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein, Sarcoplasmic reticulum membrane.
Customer validation	WB(Mus musculus) IP(Homo sapiens)