제품 > 항체 > 다중클론항체(pAb)

SF3A1 Rabbit pAb (A4399)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using SF3A1 Rabbit pAb (A4399) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Review

Overview

Product name	SF3A1 Rabbit pAb
Catalog No.	A4399
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a subunit of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer is a component of the mature U2 small nuclear ribonucleoprotein particle (snRNP). U2 small nuclear ribonucleoproteins play a critical role in spliceosome assembly and pre-mRNA splicing.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 715-785 of human SF3A1 (Q15459).
Sequence	QDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLAL
Gene ID
Swiss Prot
Synonyms	PRP21; PRPF21; SAP114; SF3A120; SF3A1
Calculated MW	89kDa
Observed MW	130kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Rat brain, Rat lung
Cellular location	Nucleus
Customer validation	(293T)