Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | SFTPC Rabbit pAb |
---|---|
Catalog No. | A11764 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 59-197 of human SFTPC (NP_003009.2). |
---|---|
Sequence | HMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCGEVPLYYI |
Gene ID | |
Swiss Prot | |
Synonyms | SP5; SP-C; PSP-C; SFTP2; SMDP2; BRICD6; SFTPC |
Calculated MW | 21kDa |
Observed MW | 21kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Rat lung |
Cellular location | Secreted, extracellular space, surface film |
Customer validation | WB(Homo sapiens) ChIP(Homo sapiens) Other(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11764? Please let us know so that we can cite the reference in this datasheet.