Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SH3KBP1 Rabbit pAb |
---|---|
Catalog No. | A1952 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 136-271 of human SH3KBP1 (NP_114098.1). |
---|---|
Sequence | WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY |
Gene ID | |
Swiss Prot | |
Synonyms | HSB1; AGMX2; CIN85; GIG10; HSB-1; IMD61; MIG18; CD2BP3; SH3KBP1 |
Calculated MW | 73kDa |
Observed MW | 73kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | THP-1 |
Cellular location | Cell junction, Cytoplasm, Cytoplasmic vesicle membrane, Peripheral membrane protein, cytoskeleton, focal adhesion, synapse, synaptosome |
Customer validation | IF(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1952? Please let us know so that we can cite the reference in this datasheet.