제품 > 항체 > 다중클론항체(pAb)

SH3KBP1 Rabbit pAb (A1952)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from THP-1 cells, using SH3KBP1 Rabbit pAb (A1952) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	SH3KBP1 Rabbit pAb
Catalog No.	A1952
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an adapter protein that contains one or more N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 136-271 of human SH3KBP1 (NP_114098.1).
Sequence	WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY
Gene ID
Swiss Prot
Synonyms	HSB1; AGMX2; CIN85; GIG10; HSB-1; IMD61; MIG18; CD2BP3; SH3KBP1
Calculated MW	73kDa
Observed MW	73kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1
Cellular location	Cell junction, Cytoplasm, Cytoplasmic vesicle membrane, Peripheral membrane protein, cytoskeleton, focal adhesion, synapse, synaptosome
Customer validation	IF(Mus musculus)