제품 > 항체 > 다중클론항체(pAb)

SLC17A1 Rabbit pAb (A16642)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of lysates from Rat liver, using SLC17A1 Rabbit pAb (A16642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Review

Overview

Product name	SLC17A1 Rabbit pAb
Catalog No.	A16642
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable sialic acid transmembrane transporter activity. Involved in urate metabolic process and urate transport. Located in apical plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC17A1 (NP_005065.2).
Sequence	MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGY
Gene ID
Swiss Prot
Synonyms	NPT1; NPT-1; NAPI-1; SLC17A1
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat liver
Cellular location	apical plasma membrane, lysosome, plasma membrane
Customer validation	(Mouse Monocyte Macrophage Leukemia Cells) WB(Mus musculus)