제품 > 항체 > 다중클론항체(pAb)

SLC17A6 Rabbit pAb (A15177)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SLC17A6 Polyclonal Antibody (A15177) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SLC17A6 Rabbit pAb (A15177)

Immunofluorescence analysis of rat brain using SLC17A6 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse brain using SLC17A6 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	SLC17A6 Rabbit pAb
Catalog No.	A15177
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable L-glutamate transmembrane transporter activity and neurotransmitter transmembrane transporter activity. Involved in neurotransmitter loading into synaptic vesicle. Predicted to be located in synaptic vesicle. Predicted to be active in excitatory synapse. Predicted to be integral component of synaptic vesicle membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-582 of human SLC17A6 (NP_065079.1).
Sequence	GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Gene ID
Swiss Prot
Synonyms	DNPI; VGLUT2
Calculated MW	64kDa
Observed MW	64kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SKOV3, SH-SY5Y, U-251MG
Cellular location	Cell junction, Cytoplasmic vesicle, Membrane, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome
Customer validation	WB(Mus musculus)