Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SLC17A6 Rabbit pAb |
---|---|
Catalog No. | A15177 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-582 of human SLC17A6 (NP_065079.1). |
---|---|
Sequence | GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS |
Gene ID | |
Swiss Prot | |
Synonyms | DNPI; VGLUT2 |
Calculated MW | 64kDa |
Observed MW | 64kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | SKOV3, SH-SY5Y, U-251MG |
Cellular location | Cell junction, Cytoplasmic vesicle, Membrane, Multi-pass membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15177? Please let us know so that we can cite the reference in this datasheet.