제품 > 항체 > 다중클론항체(pAb)

SLC25A11 Rabbit pAb (A25022)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SLC25A11 Rabbit pAb (A25022) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 45s.

Overview

Product name	SLC25A11 Rabbit pAb
Catalog No.	A25022
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC25A11(NP_003553.2).
Sequence	MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLG
Gene ID
Swiss Prot
Synonyms	OGC; PGL6; SLC20A4; SLC25A11
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, Mouse liver
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) Co-IP(Homo sapiens, Mus musculus) RT-PCR(Homo sapiens, Mus musculus)