Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SLC25A20 Rabbit mAb |
---|---|
Catalog No. | A23763 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC59015 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC25A20. (NP_000378.1). |
---|---|
Sequence | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQ |
Gene ID | |
Swiss Prot | |
Synonyms | SLC25A20; CAC; CACT; solute carrier family 25 member 20 |
Calculated MW | 32kDa |
Observed MW | 33kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse lung, Rat lung |
Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein. |
Customer validation | IHC(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23763? Please let us know so that we can cite the reference in this datasheet.