Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SLC25A31 Rabbit pAb |
---|---|
Catalog No. | A16577 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A31 (NP_112581.1). |
---|---|
Sequence | NFAFKDKYKQLFMSGVNKEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYR |
Gene ID | |
Swiss Prot | |
Synonyms | AAC4; ANT4; ANT 4; SFEC35kDa; SLC25A31 |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse testis, Rat testis |
Cellular location | Cell projection, Mitochondrion inner membrane, Multi-pass membrane protein, cilium, flagellum |
* For research use only. Not for therapeutic or diagnostic purposes.