Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SLC28A2 Rabbit pAb |
---|---|
Catalog No. | A16086 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2). |
---|---|
Sequence | GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI |
Gene ID | |
Swiss Prot | |
Synonyms | CNT2; HCNT2; SPNT1; HsT17153; SLC28A2 |
Calculated MW | 72kDa |
Observed MW | 72kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, 293T, HT-29, BxPC-3, Mouse heart, Mouse spleen, Rat liver, Rat heart |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | WB(Chlorocebus aethiops ) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16086? Please let us know so that we can cite the reference in this datasheet.