Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SLC2A8 Rabbit pAb |
---|---|
Catalog No. | A16521 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human SLC2A8 (NP_055395.2). |
---|---|
Sequence | CFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIG |
Gene ID | |
Swiss Prot | |
Synonyms | GLUT8; GLUTX1; SLC2A8 |
Calculated MW | 51kDa |
Observed MW | 51kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse testis, Mouse brain, Mouse heart, Rat testis |
Cellular location | Cell membrane, Cytoplasmic vesicle membrane, Multi-pass membrane protein |
Customer validation | WB(Gallus gallus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16521? Please let us know so that we can cite the reference in this datasheet.