Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SLC38A3 Rabbit pAb |
---|---|
Catalog No. | A4472 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1). |
---|---|
Sequence | MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK |
Gene ID | |
Swiss Prot | |
Synonyms | G17; SN1; NAT1; SNAT3; DEE102; SLC38A3 |
Calculated MW | 56kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, Raji, Mouse brain |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Gallus gallus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4472? Please let us know so that we can cite the reference in this datasheet.