제품 > 항체 > 다중클론항체(pAb)

SLC38A3 Rabbit pAb (A4472)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SLC38A3 Rabbit pAb (A4472).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Overview

Product name	SLC38A3 Rabbit pAb
Catalog No.	A4472
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables L-amino acid transmembrane transporter activity. Involved in amino acid transport. Located in plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1).
Sequence	MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK
Gene ID
Swiss Prot
Synonyms	G17; SN1; NAT1; SNAT3; DEE102; SLC38A3
Calculated MW	56kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Raji, Mouse brain
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Gallus gallus)