제품 > 항체 > 다중클론항체(pAb)

SLC44A4 Rabbit pAb (A10435)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using SLC44A4 antibody (A10435) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	SLC44A4 Rabbit pAb
Catalog No.	A10435
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2).
Sequence	LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAR
Gene ID
Swiss Prot
Synonyms	CTL4; NG22; TPPT; DFNA72; hTPPT1; C6orf29
Calculated MW	79kDa
Observed MW	79kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, K-562, Mouse kidney, Mouse lung
Cellular location	Membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus, Homo sapiens)