Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SLC44A4 Rabbit pAb |
---|---|
Catalog No. | A10435 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 65-215 of human SLC44A4 (NP_079533.2). |
---|---|
Sequence | LYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNAR |
Gene ID | |
Swiss Prot | |
Synonyms | CTL4; NG22; TPPT; DFNA72; hTPPT1; C6orf29 |
Calculated MW | 79kDa |
Observed MW | 79kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HT-29, K-562, Mouse kidney, Mouse lung |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | WB(Mus musculus, Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10435? Please let us know so that we can cite the reference in this datasheet.