Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SLC46A2 Rabbit pAb |
---|---|
Catalog No. | A15494 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC46A2 (NP_149040.3). |
---|---|
Sequence | MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISIC |
Gene ID | |
Swiss Prot | |
Synonyms | Ly110; TSCOT; SLC46A2 |
Calculated MW | 51kDa |
Observed MW | 51kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | LO2, Raji, MCF7, Mouse heart, Mouse brain, Mouse spleen |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | IP(Homo sapiens) WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15494? Please let us know so that we can cite the reference in this datasheet.