Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | SLC52A3 Rabbit pAb |
---|---|
Catalog No. | A15935 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3). |
---|---|
Sequence | PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL |
Gene ID | |
Swiss Prot | |
Synonyms | RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1; SLC52A3 |
Calculated MW | 51kDa |
Observed MW | 51kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse kidney |
Cellular location | Apical cell membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15935? Please let us know so that we can cite the reference in this datasheet.