제품 > 항체 > 다중클론항체(pAb)

SLC52A3 Rabbit pAb (A15935)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from mouse kidney, using SLC52A3 Rabbit pAb (A15935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	SLC52A3 Rabbit pAb
Catalog No.	A15935
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a riboflavin transporter protein that is strongly expressed in the intestine and likely plays a role in intestinal absorption of riboflavin. The protein is predicted to have eleven transmembrane domains and a cell surface localization signal in the C-terminus. Mutations at this locus have been associated with Brown-Vialetto-Van Laere syndrome and Fazio-Londe disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC52A3 (NP_212134.3).
Sequence	PGMEAPLSHLESRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVDSSQGQGYLEEKAAPCCPAHL
Gene ID
Swiss Prot
Synonyms	RFT2; BVVLS; RFVT3; hRFT2; BVVLS1; C20orf54; bA371L19.1; SLC52A3
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse kidney
Cellular location	Apical cell membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens, Mus musculus)