제품 > 항체 > 다중클론항체(pAb)

SMYD5 Rabbit pAb (A6191)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunofluorescence analysis of A549 cells using SMYD5 Rabbit pAb (A6191). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	SMYD5 Rabbit pAb
Catalog No.	A6191
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable histone methyltransferase activity (H4-K20 specific). Involved in negative regulation of transposition and regulation of stem cell differentiation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SMYD5 (NP_006053.2).
Sequence	LNCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADEPNVTSEEEEEEEE
Gene ID
Swiss Prot
Synonyms	RRG1; RAI15; NN8-4AG; ZMYND23; SMYD5
Calculated MW	47kDa
Observed MW	48kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples	HepG2, MCF7, HL-60, HeLa, SW480, Mouse skeletal muscle
Cellular location
Customer validation	(HeLa) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SMYD5 Rabbit pAb images

Immunofluorescence - SMYD5 Rabbit pAb (A6191)

Immunofluorescence analysis of A549 cells using SMYD5 Rabbit pAb (A6191). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.