Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SNX9 Rabbit pAb |
---|---|
Catalog No. | A0977 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human SNX9 (NP_057308.1). |
---|---|
Sequence | MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG |
Gene ID | |
Swiss Prot | |
Synonyms | SDP1; WISP; SH3PX1; SH3PXD3A; SNX9 |
Calculated MW | 67kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A375, HeLa, Mouse liver, Rat liver, Rat heart |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Golgi apparatus, Peripheral membrane protein, clathrin-coated vesicle, ruffle, trans-Golgi network |
Customer validation | WB(Anatinae, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0977? Please let us know so that we can cite the reference in this datasheet.