Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SOCS3 Rabbit mAb |
---|---|
Catalog No. | A21981 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53312 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 126-225 of human SOCS3 (NP_003946.3). |
---|---|
Sequence | HYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Gene ID | |
Swiss Prot | |
Synonyms | CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3; SOCS3 |
Calculated MW | 25kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | RAW 264.7 treated by LPS, 293T transfected with SOCS3 |
Cellular location | Cytosol. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21981? Please let us know so that we can cite the reference in this datasheet.