제품 > 항체 > 다중클론항체(pAb)

SORT1 Rabbit pAb (A7926)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SORT1 Rabbit pAb (A7926) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Overview

Product name	SORT1 Rabbit pAb
Catalog No.	A7926
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 785-823 of human SORT1 (NP_002950.3).
Sequence	GRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHD
Gene ID
Swiss Prot
Synonyms	NT3; Gp95; NTR3; LDLCQ6; SORT1
Calculated MW	92kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG, PC-3, HepG2, Mouse liver, Mouse kidney, Rat brain
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Extracellular side, Golgi apparatus, Golgi stack membrane, Lysosome membrane, Membrane, Nucleus membrane, Single-pass type I membrane protein.