Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STING/TMEM173 Rabbit pAb |
---|---|
Catalog No. | A20175 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 280-371 of mouse STING. (NP_938023.1). |
---|---|
Sequence | SREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKP |
Gene ID | |
Swiss Prot | |
Synonyms | ERIS; MPYS; Mita; STING; Tmem173; STING-beta; 2610307O08Rik |
Calculated MW | 43kDa |
Observed MW | 33kDa/35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, A-549, RAW264.7 |
Cellular location | autophagosome, cytoplasm, cytosol, endoplasmic reticulum, endosome, Golgi apparatus, mitochondrial outer membrane, nucleoplasm, perinuclear region of cytoplasm, peroxisome, plasma membrane. |
Customer validation | WB(Mus musculus, Mus musculus , Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20175? Please let us know so that we can cite the reference in this datasheet.