제품 > 항체 > 다중클론항체(pAb)

STRN Rabbit pAb (A7734)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using STRN Rabbit pAb (A7734) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - STRN Rabbit pAb (A7734)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using STRN Rabbit pAb (A7734) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat heart using STRN Rabbit pAb (A7734) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human liver damage using STRN Rabbit pAb (A7734) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	STRN Rabbit pAb
Catalog No.	A7734
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables armadillo repeat domain binding activity; estrogen receptor binding activity; and protein phosphatase 2A binding activity. Involved in Wnt signaling pathway and negative regulation of cell population proliferation. Located in bicellular tight junction. Part of FAR/SIN/STRIPAK complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 581-780 of human STRN (NP_003153.2).
Sequence	HQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV
Gene ID
Swiss Prot
Synonyms	SG2NA; STRN1; PPP2R6A; STRN
Calculated MW	86kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A-549, NIH/3T3, Mouse lung, Rat brain
Cellular location	Cell projection, Cytoplasm, Membrane, Peripheral membrane protein, dendritic spine
Customer validation	WB(Micrococcus luteus, Staphylococcus aureus )