제품 > 항체 > 다중클론항체(pAb)

SUPT6H Rabbit pAb (A16434)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SUPT6H Rabbit pAb (A16434) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SUPT6H Rabbit pAb (A16434)

Immunofluorescence analysis of U-2 OS cells using SUPT6H Rabbit pAb (A16434) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SUPT6H Rabbit pAb (A16434)

Immunoprecipitation analysis of 600 μg extracts of Mouse heart using 3 μg SUPT6H antibody (A16434). Western blot was performed from the immunoprecipitate using SUPT6H antibody (A16434) at a dilution of 1:500.

Overview

Product name	SUPT6H Rabbit pAb
Catalog No.	A16434
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables histone binding activity. Involved in negative regulation of histone H3-K27 methylation and positive regulation of transcription elongation from RNA polymerase II promoter. Predicted to be located in nucleoplasm. Predicted to be part of transcription elongation factor complex. Predicted to be active in transcriptionally active chromatin.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1500-1726 of human SUPT6H (NP_003161.2).
Sequence	IFPTVNGLFRWFKDHYQDPVPGITPSSSSRTRTPASINATPANINLADLTRAVNALPQNMTSQMFSAIAAVTGQGQNPNATPAQWASSQYGYGGSGGGSSAYHVFPTPAQQPVATPLMTPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Gene ID
Swiss Prot
Synonyms	SPT6; SPT6H; emb-5; SUPT6H
Calculated MW	199kDa
Observed MW	260kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	U-87MG, Jurkat, HeLa, Mouse brain, Mouse heart, Mouse liver
Cellular location	Nucleus