제품 > 항체 > 다중클론항체(pAb)

SUPV3L1 Rabbit pAb (A9951)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SUPV3L1 antibody (A9951) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - SUPV3L1 Rabbit pAb (A9951)

Immunofluorescence analysis of NIH-3T3 cells using SUPV3L1 Polyclonal Antibody (A9951) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	SUPV3L1 Rabbit pAb
Catalog No.	A9951
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables helicase activity; nucleic acid binding activity; and protein homodimerization activity. Involved in several processes, including mitochondrial RNA metabolic process; mitochondrion morphogenesis; and positive regulation of mitochondrial RNA catabolic process. Located in mitochondrial nucleoid and nucleus. Part of mitochondrial degradosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 577-786 of human SUPV3L1 (NP_003162.2).
Sequence	APINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD
Gene ID
Swiss Prot
Synonyms	SUV3
Calculated MW	88kDa
Observed MW	88kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	K-562, Raji, Jurkat, SW620, Mouse heart, Mouse kidney, Mouse liver
Cellular location	Mitochondrion matrix, Nucleus, mitochondrion nucleoid
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달RNA 결합

SUPV3L1 Rabbit pAb images

Western blot - SUPV3L1 Rabbit pAb (A9951)

Immunofluorescence - SUPV3L1 Rabbit pAb (A9951)

Immunofluorescence analysis of NIH-3T3 cells using SUPV3L1 Polyclonal Antibody (A9951) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.