Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | SYT1 Rabbit pAb |
---|---|
Catalog No. | A24840 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SYT1(NP_005630.1). |
---|---|
Sequence | MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKN |
Gene ID | |
Swiss Prot | |
Synonyms | SYT1; P65; SVP65; SYT; synaptotagmin-1 |
Calculated MW | 47kDa |
Observed MW | 60kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Single-pass membrane protein, chromaffin granule membrane, secretory vesicle, synaptic vesicle membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.