제품 > 항체 > 다중클론항체(pAb)

Septin 9 Rabbit pAb (A8657)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Septin 9 antibody (A8657) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - Septin 9 Rabbit pAb (A8657)

Confocal immunofluorescence analysis of U2OS cells using Septin 9 Polyclonal Antibody (A8657) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	Septin 9 Rabbit pAb
Catalog No.	A8657
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Septin 9 (NP_001106964.1).
Sequence	MEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPV
Gene ID
Swiss Prot
Synonyms	MSF; MSF1; NAPB; SEPT9; SINT1; PNUTL4; SeptD1; AF17q25
Calculated MW	65kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat, HeLa, 293T, U-87MG
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Mus musculus) IF(Mus musculus)