제품 > 항체 > 다중클론항체(pAb)

Smad1/Smad5/Smad9 Rabbit pAb (A23208)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from C2C12 cells using Smad1/Smad5/Smad9 Rabbit pAb (A23208) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - Smad1/Smad5/Smad9 Rabbit pAb (A23208)

Immunofluorescence analysis of HeLa cells using Smad1/Smad5/Smad9 Rabbit pAb(A23208) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Smad1/Smad5/Smad9 Rabbit pAb
Catalog No.	A23208
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 19-125 of human Smad1/Smad5/Smad9(NP_005891.1).
Sequence	GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPY
Gene ID
Swiss Prot
Synonyms	Smad1/Smad5/Smad9
Calculated MW	52kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	C2C12
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Mus musculus)