제품 > 항체 > 단일클론항체(mAb)

Syntaxin 4 Rabbit mAb (A5996)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Syntaxin 4 Rabbit mAb (A5996) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts of Rat brain, using Syntaxin 4 Rabbit mAb (A5996) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Syntaxin 4 Rabbit mAb (A5996)

Immunofluorescence analysis of NIH-3T3 cells using Syntaxin 4 Rabbit mAb (A5996) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Syntaxin 4 Rabbit mAb
Catalog No.	A5996
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2113

Background

Enables sphingomyelin phosphodiesterase activator activity. Involved in several processes, including cornified envelope assembly; positive regulation of immune effector process; and positive regulation of protein localization. Located in several cellular components, including basolateral plasma membrane; cytoplasmic vesicle; and lamellipodium. Part of SNARE complex. Is active in glutamatergic synapse and postsynapse.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)).
Sequence	QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
Gene ID
Swiss Prot
Synonyms	STX4A; p35-2
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A549, Mouse lung, Rat brain
Cellular location	basolateral plasma membrane, cytosol, dendritic spine, endosome, extracellular exosome, extracellular space, glutamatergic synapse, lateral loop, myelin sheath adaxonal region, neuron projection membrane, perinuclear region of cytoplasm, plasma membrane, postsynapse, presynaptic active zone membrane, SNARE complex, synapse, synaptic vesicle, trans-Golgi network
Customer validation	WB(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens)