제품 > 항체 > 단일클론항체(mAb)

Syntaxin Rabbit mAb (A19813)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Syntaxin Rabbit mAb (A19813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat spinal cord, using Syntaxin Rabbit mAb (A19813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Syntaxin Rabbit mAb (A19813)

Immunohistochemistry analysis of Syntaxin in paraffin-embedded human pancreas tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse brain tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Syntaxin in paraffin-embedded human brain tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Syntaxin in paraffin-embedded human colon tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Syntaxin in paraffin-embedded mouse testis tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Syntaxin in paraffin-embedded rat brain tissue using Syntaxin Rabbit mAb (A19813) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Syntaxin Rabbit mAb (A19813)

Immunofluorescence analysis of paraffin-embedded rat brain using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse brain using Syntaxin Rabbit mAb (A19813) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Syntaxin Rabbit mAb
Catalog No.	A19813
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2339

Background

The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of transmitters from neurons plays an important role in synaptic transmission. After exocytosis, the membrane and proteins from the vesicle are retrieved from the plasma membrane through the process of endocytosis. Mutations in this gene have been identified as one cause of fever-associated epilepsy syndromes. A possible link between this gene and Parkinson's disease has also been suggested. [provided by RefSeq, Jan 2015]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin (P61266).
Sequence	MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIE
Gene ID
Swiss Prot
Synonyms	STX1A/STX1B/STX2/STX3; Syntaxin
Calculated MW	33kDa
Observed MW	35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse spinal cord, Mouse brain, Rat spinal cord
Cellular location	axon, centrosome, cytoplasm, cytosol, microtubule organizing center, neuromuscular junction, nuclear lamina, nucleoplasm, nucleus, plasma membrane, presynaptic active zone membrane, SNARE complex, spindle, synaptic vesicle
Customer validation	IP(Homo sapiens) IHC(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus)