제품 > 항체 > 다중클론항체(pAb)

TLN1 Rabbit pAb (A4158)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of U-87MG cells, using TLN1 antibody (A4158) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunofluorescence - TLN1 Rabbit pAb (A4158)

Immunofluorescence analysis of rat Intestine using TLN1 antibody (A4158) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of human colon carcinoma using TLN1 antibody (A4158) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	TLN1 Rabbit pAb
Catalog No.	A4158
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a cytoskeletal protein that is concentrated in areas of cell-substratum and cell-cell contacts. The encoded protein plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. It codistributes with integrins in the cell surface membrane in order to assist in the attachment of adherent cells to extracellular matrices and of lymphocytes to other cells. The N-terminus of this protein contains elements for localization to cell-extracellular matrix junctions. The C-terminus contains binding sites for proteins such as beta-1-integrin, actin, and vinculin.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TLN1 (NP_006280.3).
Sequence	MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQAR
Gene ID
Swiss Prot
Synonyms	TLN; ILWEQ; talin-1
Calculated MW	270kDa
Observed MW	240kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG
Cellular location	Cell junction, Cell projection, Cell surface, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, focal adhesion, ruffle membrane
Customer validation	WB(Mus musculus)