Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | TLR7 Rabbit mAb |
---|---|
Catalog No. | A19126 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0401 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human TLR7 (Q9NYK1). |
---|---|
Sequence | SKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV |
Gene ID | |
Swiss Prot | |
Synonyms | IMD74; SLEB17; TLR7-like; TLR7 |
Calculated MW | 121kDa |
Observed MW | 140kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji |
Cellular location | Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Lysosome, Single-pass type I membrane protein, phagosome. |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19126? Please let us know so that we can cite the reference in this datasheet.