Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | TMEM100 Rabbit pAb |
---|---|
Catalog No. | A16653 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human TMEM100 (NP_001093110.1). |
---|---|
Sequence | ELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA |
Gene ID | |
Swiss Prot | |
Synonyms | TMEM100 |
Calculated MW | 14kDa |
Observed MW | 14kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, SH-SY5Y, Mouse lung |
Cellular location | endoplasmic reticulum, perikaryon, perinuclear region of cytoplasm, plasma membrane |
Customer validation | WB(Homo sapiens) IF(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16653? Please let us know so that we can cite the reference in this datasheet.