제품 > 항체 > 다중클론항체(pAb)

TMEM100 Rabbit pAb (A16653)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using TMEM100 Rabbit pAb (A16653) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	TMEM100 Rabbit pAb
Catalog No.	A16653
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in BMP signaling pathway. Located in several cellular components, including endoplasmic reticulum; perikaryon; and perinuclear region of cytoplasm.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human TMEM100 (NP_001093110.1).
Sequence	ELSCYRCIIPFAVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRESQTALVANQRSLFA
Gene ID
Swiss Prot
Synonyms	TMEM100
Calculated MW	14kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, SH-SY5Y, Mouse lung
Cellular location	endoplasmic reticulum, perikaryon, perinuclear region of cytoplasm, plasma membrane
Customer validation	WB(Homo sapiens) IF(Homo sapiens)