제품 > 항체 > 다중클론항체(pAb)

TNFRSF17 Rabbit pAb (A10707)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using TNFRSF17 antibody (A10707) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of extracts of Rat spleen, using TNFRSF17 antibody (A10707) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - TNFRSF17 Rabbit pAb (A10707)

Immunofluorescence analysis of SP2/0 cells using TNFRSF17 Rabbit pAb (A10707) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-937 cells using TNFRSF17 Rabbit pAb (A10707) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	TNFRSF17 Rabbit pAb
Catalog No.	A10707
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFRSF17 (NP_001183.2).
Sequence	MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
Gene ID
Swiss Prot
Synonyms	BCM; BCMA; CD269; TNFRSF13A
Calculated MW	20kDa
Observed MW	15-35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SP2/0, Raji, Rat spleen
Cellular location	Cell membrane, Endomembrane system, Single-pass type III membrane protein