제품 > 항체 > 다중클론항체(pAb)

TOMM7 Rabbit pAb (A17711)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293F cells, using TOMM7 Rabbit pAb (A17711) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	TOMM7 Rabbit pAb
Catalog No.	A17711
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-55 of human TOMM7 (NP_061932.1).
Sequence	MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
Gene ID
Swiss Prot
Synonyms	TOM7; TOMM7
Calculated MW	6kDa
Observed MW	11kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293F
Cellular location	mitochondrial outer membrane, mitochondrion.
Customer validation	WB(Homo sapiens, Mus musculus)