Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TPO-R/CD110/c-Mpl Rabbit mAb |
---|---|
Catalog No. | A19729 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2257 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 536-635 of human TPO-R/CD110/c-Mpl (P40238). |
---|---|
Sequence | HRVLGQYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP |
Gene ID | |
Swiss Prot | |
Synonyms | MPLV; TPOR; C-MPL; CD110; THPOR; THCYT2; TPO-R/CD110/c-Mpl |
Calculated MW | 71kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Raji, THP-1, Mouse liver, Mouse spleen, Mouse heart, Rat liver |
Cellular location | cell surface, external side of plasma membrane, Golgi apparatus, nuclear membrane, plasma membrane. |
Customer validation | WB(Gallus gallus) IHC(Other) RNA-Seq(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19729? Please let us know so that we can cite the reference in this datasheet.