제품 > 항체 > 다중클론항체(pAb)

TRAF7 Rabbit pAb (A15912)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of various lysates using TRAF7 Rabbit pAb (A15912) at 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Overview

Product name	TRAF7 Rabbit pAb
Catalog No.	A15912
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2).
Sequence	PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW
Gene ID
Swiss Prot
Synonyms	RFWD1; RNF119; CAFDADD; TRAF7
Calculated MW	75kDa
Observed MW	75kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat testis, Rat heart
Cellular location	Cytoplasmic vesicle