Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | TRIM63 Rabbit pAb |
---|---|
Catalog No. | A3101 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 253-353 of human TRIM63 (NP_115977.2). |
---|---|
Sequence | LDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ |
Gene ID | |
Swiss Prot | |
Synonyms | IRF; SMRZ; MURF1; MURF2; RNF28 |
Calculated MW | 40kDa |
Observed MW | 47kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293F, Rat heart |
Cellular location | Cytoplasm, M line, Nucleus, Z line, myofibril, sarcomere |
Customer validation | WB(Sus scrofa, Homo sapiens, Mus musculus, Rattus norvegicus, Ochotona princeps) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3101? Please let us know so that we can cite the reference in this datasheet.