제품 > 항체 > 다중클론항체(pAb)

Tenascin C Rabbit pAb (A18156)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse brain using Tenascin C Rabbit pAb(A18156) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Tenascin C Rabbit pAb (A18156)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Tenascin C Rabbit pAb (A18156) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Tenascin C Rabbit pAb (A18156) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Tenascin C Rabbit pAb (A18156)

Immunofluorescence analysis of U-87MG cells using Tenascin C Rabbit pAb (A18156) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Tenascin C Rabbit pAb
Catalog No.	A18156
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1990-2201 of human Tenascin C (NP_002151.2).
Sequence	NGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Gene ID
Swiss Prot
Synonyms	GP; JI; TN; HXB; GMEM; TN-C; DFNA56; 150-225; Tenascin C
Calculated MW	241kDa
Observed MW	240-260kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain
Cellular location	basement membrane, endoplasmic reticulum lumen, extracellular region, extracellular space, focal adhesion
Customer validation	IF(Homo sapiens) IHC(Rattus norvegicus)