Review (2)Publications (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | UQCRC2 Rabbit mAb |
---|---|
Catalog No. | A4366 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0982 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human UQCRC2 (P22695). |
---|---|
Sequence | KANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDV |
Gene ID | |
Swiss Prot | |
Synonyms | QCR2; UQCR2; MC3DN5; UQCRC2 |
Calculated MW | 48kDa |
Observed MW | 48kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, HepG2, A-549, Mouse heart, Rat brain, Rat heart |
Cellular location | Mitochondrion inner membrane. |
Customer validation | (HepG2 、MCF-7、MLOT-4 、T-47D , 293T,Hela,A549,HL-60,HepG2,MCF-7,Molt-4,T47D,jurkat) WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A4366? Please let us know so that we can cite the reference in this datasheet.