제품 > 항체 > 다중클론항체(pAb)

UQCRQ Rabbit pAb (A9872)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using UQCRQ Rabbit pAb (A9872) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	UQCRQ Rabbit pAb
Catalog No.	A9872
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-82 of human UQCRQ (NP_055217.2).
Sequence	MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
Gene ID
Swiss Prot
Synonyms	QPC; QCR8; QP-C; UQCR7; MC3DN4
Calculated MW	10kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SW620, Mouse heart
Cellular location	Mitochondrion inner membrane
Customer validation	WB(Mus musculus)