Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | USO1 Rabbit mAb |
---|---|
Catalog No. | A20950 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2937 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USO1 (O60763). |
---|---|
Sequence | MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEE |
Gene ID | |
Swiss Prot | |
Synonyms | TAP; VDP; P115; USO1 |
Calculated MW | 108kDa |
Observed MW | 115kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HepG2, 293T, K-562, MCF7, Mouse thymus, Rat liver |
Cellular location | Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, cytosol. |
Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20950? Please let us know so that we can cite the reference in this datasheet.