제품 > 항체 > 단일클론항체(mAb)

USP9X Rabbit mAb (A9782)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using USP9X Rabbit mAb (A9782) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - USP9X Rabbit mAb (A9782)

Immunohistochemistry analysis of paraffin-embedded Rat testis using USP9X Rabbit mAb (A9782) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using USP9X Rabbit mAb (A9782) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - USP9X Rabbit mAb (A9782)

Immunofluorescence analysis of NIH-3T3 cells using USP9X Rabbit mAb (A9782) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	USP9X Rabbit mAb
Catalog No.	A9782
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1748

Background

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (Q93008).
Sequence	MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA
Gene ID
Swiss Prot
Synonyms	FAF; FAM; hFAM; DFFRX; MRX99; XLID99; MRXS99F; USP9X
Calculated MW	290kDa
Observed MW	270kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, C6, U-251 MG, Mouse testis, Mouse brain
Cellular location	cilium, cytoplasm, cytoskeleton, cytosol, nucleus
Customer validation	WB(Homo sapiens) IP(Homo sapiens)