제품 > 항체 > 다중클론항체(pAb)

Uhrf2 Rabbit pAb (A13647)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using Uhrf2 antibody (A13647) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	Uhrf2 Rabbit pAb
Catalog No.	A13647
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation; protein autoubiquitination; and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system; ear; early conceptus; female reproductive system; and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 76-359 of mouse Uhrf2 (NP_659122.2).
Sequence	DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM
Gene ID
Swiss Prot
Synonyms	Nirf; 2310065A22Rik; D130071B19Rik
Calculated MW	90kDa
Observed MW	90kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse thymus, Mouse testis, Mouse liver, Rat thymus
Cellular location	Nucleus